Loading...
Statistics
Advertisement

Mmatrainingwomen.com

Advertisement
Mmatrainingwomen.com is hosted in United States / Scottsdale . Mmatrainingwomen.com doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: Html, Html5, Iframe, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.5.

Technologies in use by Mmatrainingwomen.com

Technology

Number of occurences: 3
  • Html
  • Html5
  • Iframe

Advertisement

Server Type

  • Microsoft-IIS/7.5

Powered by

  • ASP.NET

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Mmatrainingwomen.com

Missing HTTPS protocol.

    Meta - Mmatrainingwomen.com

    Number of occurences: 0

    Server / Hosting

    • IP: 184.168.221.47
    • Latitude: 33.61
    • Longitude: -111.89
    • Country: United States
    • City: Scottsdale

    Rname

    • ns45.domaincontrol.com
    • ns46.domaincontrol.com
    • mailstore1.secureserver.net
    • smtp.secureserver.net

    Target

    • dns.jomax.net

    HTTP Header Response

    HTTP/1.1 200 OK Cache-Control: no-cache Pragma: no-cache Content-Type: text/html; charset=utf-8 Expires: -1 Server: Microsoft-IIS/7.5 X-AspNet-Version: 4.0.30319 X-Powered-By: ASP.NET Date: Sat, 10 Sep 2016 13:30:44 GMT Content-Length: 303 Age: 1 X-Cache: MISS from s_wx1123 X-Cache-Lookup: MISS from s_wx1123:80 Via: 1.1 s_wx1123 (squid/3.5.20) Connection: keep-alive

    DNS

    host: mmatrainingwomen.com
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 184.168.221.47
    host: mmatrainingwomen.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns45.domaincontrol.com
    host: mmatrainingwomen.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns46.domaincontrol.com
    host: mmatrainingwomen.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns45.domaincontrol.com
    5. rname: dns.jomax.net
    6. serial: 2016081700
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 600
    host: mmatrainingwomen.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mailstore1.secureserver.net
    host: mmatrainingwomen.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 0
    5. target: smtp.secureserver.net

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.matrainingwomen.com, www.mpmatrainingwomen.com, www.pmatrainingwomen.com, www.momatrainingwomen.com, www.omatrainingwomen.com, www.mimatrainingwomen.com, www.imatrainingwomen.com, www.mkmatrainingwomen.com, www.kmatrainingwomen.com, www.m.matrainingwomen.com, www..matrainingwomen.com, www.mumatrainingwomen.com, www.umatrainingwomen.com, www.mjmatrainingwomen.com, www.jmatrainingwomen.com, www.mnmatrainingwomen.com, www.nmatrainingwomen.com, www.m-matrainingwomen.com, www.-matrainingwomen.com, www.matrainingwomen.com, www.mmpatrainingwomen.com, www.mpatrainingwomen.com, www.mmoatrainingwomen.com, www.moatrainingwomen.com, www.mmiatrainingwomen.com, www.miatrainingwomen.com, www.mmkatrainingwomen.com, www.mkatrainingwomen.com, www.mm.atrainingwomen.com, www.m.atrainingwomen.com, www.mmuatrainingwomen.com, www.muatrainingwomen.com, www.mmjatrainingwomen.com, www.mjatrainingwomen.com, www.mmnatrainingwomen.com, www.mnatrainingwomen.com, www.mm-atrainingwomen.com, www.m-atrainingwomen.com, www.mmtrainingwomen.com, www.mmaotrainingwomen.com, www.mmotrainingwomen.com, www.mmaptrainingwomen.com, www.mmptrainingwomen.com, www.mma9trainingwomen.com, www.mm9trainingwomen.com, www.mmatrainingwomen.com, www.mmtrainingwomen.com, www.mmaitrainingwomen.com, www.mmitrainingwomen.com, www.mmautrainingwomen.com, www.mmutrainingwomen.com, www.mmarainingwomen.com, www.mmatqrainingwomen.com, www.mmaqrainingwomen.com, www.mmatarainingwomen.com, www.mmaarainingwomen.com, www.mmat rainingwomen.com, www.mma rainingwomen.com, www.mmatwrainingwomen.com, www.mmawrainingwomen.com, www.mmaterainingwomen.com, www.mmaerainingwomen.com, www.mmatzrainingwomen.com, www.mmazrainingwomen.com, www.mmatxrainingwomen.com, www.mmaxrainingwomen.com, www.mmatcrainingwomen.com, www.mmacrainingwomen.com, www.mmatainingwomen.com, www.mmatriainingwomen.com, www.mmatiainingwomen.com, www.mmatroainingwomen.com, www.mmatoainingwomen.com, www.mmatrlainingwomen.com, www.mmatlainingwomen.com, www.mmatrlainingwomen.com, www.mmatlainingwomen.com, www.mmatr.ainingwomen.com, www.mmat.ainingwomen.com, www.mmatriningwomen.com, www.mmatraoiningwomen.com, www.mmatroiningwomen.com, www.mmatrapiningwomen.com, www.mmatrpiningwomen.com, www.mmatra9iningwomen.com, www.mmatr9iningwomen.com, www.mmatrainingwomen.com, www.mmatriningwomen.com, www.mmatraiiningwomen.com, www.mmatriiningwomen.com, www.mmatrauiningwomen.com, www.mmatruiningwomen.com, www.mmatraningwomen.com, www.mmatrairningwomen.com, www.mmatrarningwomen.com, www.mmatraifningwomen.com, www.mmatrafningwomen.com, www.mmatraivningwomen.com, www.mmatravningwomen.com, www.mmatraikningwomen.com, www.mmatrakningwomen.com, www.mmatrai,ningwomen.com, www.mmatra,ningwomen.com, www.mmatraibningwomen.com, www.mmatrabningwomen.com, www.mmatraigningwomen.com, www.mmatragningwomen.com, www.mmatraitningwomen.com, www.mmatratningwomen.com, www.mmatraiyningwomen.com, www.mmatrayningwomen.com, www.mmatraiuningwomen.com, www.mmatrauningwomen.com, www.mmatraijningwomen.com, www.mmatrajningwomen.com, www.mmatraimningwomen.com, www.mmatramningwomen.com, www.mmatrainningwomen.com, www.mmatranningwomen.com, www.mmatraiingwomen.com, www.mmatrainningwomen.com, www.mmatrainingwomen.com, www.mmatrainhingwomen.com, www.mmatraihingwomen.com, www.mmatrainjingwomen.com, www.mmatraijingwomen.com, www.mmatrainkingwomen.com, www.mmatraikingwomen.com, www.mmatrainlingwomen.com, www.mmatrailingwomen.com, www.mmatrain ingwomen.com, www.mmatrai ingwomen.com, www.mmatrainngwomen.com, www.mmatrainirngwomen.com, www.mmatrainrngwomen.com, www.mmatrainifngwomen.com, www.mmatrainfngwomen.com, www.mmatrainivngwomen.com, www.mmatrainvngwomen.com, www.mmatrainikngwomen.com, www.mmatrainkngwomen.com, www.mmatraini,ngwomen.com, www.mmatrain,ngwomen.com, www.mmatrainibngwomen.com, www.mmatrainbngwomen.com, www.mmatrainigngwomen.com, www.mmatraingngwomen.com, www.mmatrainitngwomen.com, www.mmatraintngwomen.com, www.mmatrainiyngwomen.com, www.mmatrainyngwomen.com, www.mmatrainiungwomen.com, www.mmatrainungwomen.com, www.mmatrainijngwomen.com, www.mmatrainjngwomen.com, www.mmatrainimngwomen.com, www.mmatrainmngwomen.com, www.mmatraininngwomen.com, www.mmatrainnngwomen.com, www.mmatrainigwomen.com, www.mmatraininngwomen.com, www.mmatrainingwomen.com, www.mmatraininhgwomen.com, www.mmatrainihgwomen.com, www.mmatraininjgwomen.com, www.mmatrainijgwomen.com, www.mmatraininkgwomen.com, www.mmatrainikgwomen.com, www.mmatraininlgwomen.com, www.mmatrainilgwomen.com, www.mmatrainin gwomen.com, www.mmatraini gwomen.com,

    Other websites we recently analyzed

    1. Vacation Homes in South West
      Find and book your perfect vacation rental Vacation Homes in South West.
      Chesterfield (United States) - 64.14.68.91
      Server software: Apache
      Technology: CSS, Html
      Number of meta tags: 3
    2. Home - Charles Galloway Photography
      United Kingdom - 79.170.40.54
      Server software: Apache/2.4.18 (Unix)
      Technology: CSS, Html, Html5, Javascript, Php
      Number of Javascript: 10
      Number of meta tags: 4
    3. CottonCandy Design Studio.
      Check out this GoDaddy hosted webpage! http://cottoncandydesign.com.
      Scottsdale (United States) - 97.74.42.79
      Server software: Microsoft-IIS/7.0
      Technology: CSS, Html, Javascript, jQuery, jQuery UI
      Number of Javascript: 4
      Number of meta tags: 3
    4. gckrt.win
      Austin (United States) - 209.99.40.227
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    5. dcixtl.cn
      Walnut (United States) - 104.217.72.157
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Php, SVG
      Number of Javascript: 2
      Number of meta tags: 3
    6. enobo.us – Elke and Oliver's Blog
      Chicago (United States) - 181.224.138.25
      Server software: nginx
      Technology: CSS, Google Font API, Gravatar, Html, Html5, Javascript, jQuery, Php, Pingback, WordPress Stats, Wordpress
      Number of Javascript: 10
      Number of meta tags: 4
    7. virgingalacticspaceflightsystems.biz
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    8. ICE COLD LOVE.COM | The Legendary – ICE COLD LOVE Website
      Houston (United States) - 192.185.13.242
      Server software: nginx/1.10.1
      Technology: CSS, Html, Html5, Javascript, jQuery, MediaElement, Php, Pingback, Wordpress
      Number of Javascript: 6
      Number of meta tags: 3
    9. PC Repair & Services, Houston, 77070
      PC Parts and Service handles all types of computers from preventive maintenance to data recovery. Customer satisfaction, trust, and privacy concerns are my number one priority.
      Scottsdale (United States) - 97.74.215.25
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery, Php
      Number of Javascript: 4
      Number of meta tags: 7
    10. Home
      Wayne (United States) - 74.208.86.136
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, Php
      Number of Javascript: 7
      Number of meta tags: 4

    Check Other Websites